topsan.wordpress.com
TOPSAN - The Network News | News of interest to The Open Protein Structure Annotation NetworkNews of interest to The Open Protein Structure Annotation Network
http://topsan.wordpress.com/
News of interest to The Open Protein Structure Annotation Network
http://topsan.wordpress.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Saturday
LOAD TIME
0.5 seconds
16x16
32x32
PAGES IN
THIS WEBSITE
10
SSL
EXTERNAL LINKS
28
SITE IP
192.0.78.12
LOAD TIME
0.453 sec
SCORE
6.2
TOPSAN - The Network News | News of interest to The Open Protein Structure Annotation Network | topsan.wordpress.com Reviews
https://topsan.wordpress.com
News of interest to The Open Protein Structure Annotation Network
TOPSAN - The Network News | News of interest to The Open Protein Structure Annotation Network | Page 2
https://topsan.wordpress.com/page/2
TOPSAN – The Network News. News of interest to The Open Protein Structure Annotation Network. November 21, 2008. Has been nominated for the wiki category by the Open Web Awards, an online voting competition. That covers major innovations in web technology. This is quite an achievement since there were 43,000 verified nominations. Is built on MindTouch’s Deki. TOPSAN endorses MindTouch Deki and if you’d like to also, go to the mashable.com voting widget on TOPSAN. And cast a vote for them. 8220;So far Wik...
TOPSAN and the Semantic Web (Part I) | TOPSAN - The Network News
https://topsan.wordpress.com/2010/06/01/96
TOPSAN – The Network News. News of interest to The Open Protein Structure Annotation Network. TOPSAN and the Semantic Web (Part I). Finally we will describe the more advanced concepts involved with the controlled ontology of predicates that the TOPSAN Protein Syntax describes. To get read more about the technologies involved you can find additional information at:. What is the semantic web:. Biohackathon semantic web series:. Day 2 — Python SPARQL query builder. Day 5 — the final day. Relationships can g...
TOPSAN and the Semantic Web (Part II) | TOPSAN - The Network News
https://topsan.wordpress.com/2010/07/12/topsan-and-the-semantic-web-part-ii
TOPSAN – The Network News. News of interest to The Open Protein Structure Annotation Network. TOPSAN and the Semantic Web (Part II). This is the second in a series of blogs in which we will try to introduce you to the concepts behind the TOPSAN Protein Syntax and the TOPSAN semantic notation system. Our first entry introduced how to imbed semantic web notations into TOPSAN ( Part I. Once you installed this library, you can use it to open and query the topsan.n3 file. Gunzip topsan.n3.gz. Print ” : ...
About | TOPSAN - The Network News
https://topsan.wordpress.com/about
TOPSAN – The Network News. News of interest to The Open Protein Structure Annotation Network. The premise of the TOPSAN project is that, no matter how much any individual knows about a particular protein, there are other members of the scientific community who know more about certain aspects of the same protein, and that the collective analysis from experts will be far more informative than any local group, let alone individual, could contribute. Any opinions expressed here, except as specifically noted,...
New TOPSAN Paper and Download Details | TOPSAN - The Network News
https://topsan.wordpress.com/2010/11/10/topsan_downloads
TOPSAN – The Network News. News of interest to The Open Protein Structure Annotation Network. New TOPSAN Paper and Download Details. A paper on TOPSAN, entitled: “ TOPSAN: a dynamic web database for structural genomics. 8221; will be featured in the Nucleic Acids Research upcoming database issue. As a brief introduction, the three formats we have provided contain semantic web related data. Which better enables data organization and easier machine parsing. The three formats include:. Is identified as TPS1...
TOTAL PAGES IN THIS WEBSITE
10
14703520 - TOPSAN
http://proteins.burnham.org/PubMed/Articles/14703520
The Open Protein Structure Annotation Network. Page last modified 20:11, 29 Jan 2010. Van den Heuvel RH, Westphal AH, Heck AJ, Walsh MA, Rovida S, van Berkel WJ, and Mattevi A. Structural studies on flavin reductase PheA2 reveal binding of NAD in an unusual folded conformation and support novel mechanism of action. J Biol Chem. 2004 Mar 26; 279(13):12860-7. Doi:10.1074/jbc.M313765200 pmid:14703520. Replace this text with your notes). Attach file or image. Attach file or image. To post a comment.
Recent changes - TOPSAN
http://proteins.burnham.org/Special:Contributions
The Open Protein Structure Annotation Network. This page can't be edited. View changes by user:. FAQs/Semantic Web/Part 2: Querying Semantic Information from TOPSAN. 141 words added, 5 words removed. Page display name changed to '3qyq'. Page content-type changed to 'application/x.deki0805 xml'. 15 words added, 6 words removed. 137 words added, 5 words removed. Page display name changed to '3uks'. Page content-type changed to 'application/x.deki0805 xml'. 135 words added, 6 words removed.
2q9k - TOPSAN
http://proteins.burnham.org/Proteins/JCSG/2q9k
The Open Protein Structure Annotation Network. Page last modified 22:33, 8 May 2012. Crystal structure of conserved uncharacterized protein (ZP 00539648.1) from Exiguobacterium sp. 255-15 at 1.59 A resolution. To be published. TPS1641,YP 001814466.1, 92207. Google Scholar output for 2q9k. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard. TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org. Ligands in PSI structures.
Templates - TOPSAN
http://proteins.burnham.org/Template:
The Open Protein Structure Annotation Network. This page can't be edited. Attach file or image. Attach file or image. All content on this site is licensed under a Creative Commons Attribution 3.0 License. Message will close by itself in. Message timer has been stopped.
TOPSAN - TOPSAN
http://proteins.burnham.org/FAQs/How_do_I_add_references%25
The Open Protein Structure Annotation Network. Page last modified 17:57, 19 Mar 2012. If you would like to start contributing, please register. If not, feel free to browse our recent annotations. The TOPSAN project was developed to collect, share, and distribute information about protein three-dimensional structures. TOPSAN serves as a portal for the scientific community to learn about protein structures solved by SG centers, and also to contribute their expertise in annotating protein function. This is ...
1o0x - TOPSAN
http://proteins.burnham.org/Proteins/JCSG/1o0x
The Open Protein Structure Annotation Network. Page last modified 19:58, 8 May 2012. Crystal structure of a methionine aminopeptidase (TM1478) from Thermotoga maritima at 1.9 A resolution. Proteins 56 396-400 2004. TPS1292,TM1478, 84823, 84817. Miriktpseiekmkkagkavavalrevrkvivpgktawdvetlvleifkklrvkpafkgyggykyatcv svneevvhglplkekvfkegdivsvdvgavyqglygdaavtyivgetdergkelvrvtrevlekaikmi kpgirlgdvshciqetvesvgfnvirdyvghgvgrelhedpqipnygtpgtgvvlrkgmtlaiepmvse gdwrvvvkedgwtavtvdgsrcahfehtilitengaeiltkeg. D Raimond...
Sitemap - TOPSAN
http://proteins.burnham.org/Special:Sitemap
The Open Protein Structure Annotation Network. This page can't be edited. AFP-DUF Annotation Jamboree 2011. How can I search TOPSAN. How can I see which author has contributed what in a page. How do I add references? How do I get an account on TOPSAN? How can I be kept updated of changes to a page's content? Making hyperlinks on the Wiki. Part 1: Using Semantic Notation on TOPSAN. Part 2: Querying Semantic Information from TOPSAN. Part 3: Downloading Semantic TOPSAN. What is the Discussions page for?
Downloads - TOPSAN
http://proteins.burnham.org/Downloads
The Open Protein Structure Annotation Network. Page last modified 23:29, 9 Nov 2010. All content on TOPSAN is licensed under a Creative Commons Attribution 3.0 License. We make downloads of the full extracted content of TOPSAN publicly available to help and enable research. The full N3 formatted semantic web extract of TOPSAN can be downloaded from http:/ files.topsan.org/topsan.n3.gz. This file is updated every 24 hours. This file is updated every 24 hours. This file is updated every 24 hours.
Template:TopsanHeader - TOPSAN
http://proteins.burnham.org/Template:TopsanHeader
The Open Protein Structure Annotation Network. Page last modified 23:52, 15 Dec 2010. The Open Protein Structure Annotation Network. Weblink(uri.build(site.uri.'/index.php', ,{title:'Special:Contributions',target:user.name}), 'Contributions') }. Weblink(site.uri.'/Special:ListRss','RSS feeds')}. Attach file or image. Attach file or image. No images to display in the gallery. To post a comment. All content on this site is licensed under a Creative Commons Attribution 3.0 License.
Talk: - TOPSAN
http://proteins.burnham.org/Talk:
The Open Protein Structure Annotation Network. Page last modified 23:47, 25 Jul 2008. This page has no content. Enrich TOPSAN by contributing. Attach file or image. Attach file or image. No images to display in the gallery. To post a comment. All content on this site is licensed under a Creative Commons Attribution 3.0 License. Message will close by itself in. Message timer has been stopped.
TOTAL LINKS TO THIS WEBSITE
28
topsan.ch - Top Team Sanitär
In Kürze finden Sie hier unseren neuen Webauftritt. Top Team Sanitär Installations GmbH. Telefon 071 626 40 50.
topsan.com - This website is for sale! - top san Resources and Information.
The domain topsan.com. May be for sale by its owner! This page provided to the domain owner free. By Sedo's Domain Parking. Disclaimer: Domain owner and Sedo maintain no relationship with third party advertisers. Reference to any specific service or trade mark is not controlled by Sedo or domain owner and does not constitute or imply its association, endorsement or recommendation.
Topsan
Content on this page requires a newer version of Adobe Flash Player. Content on this page requires a newer version of Adobe Flash Player.
topsan.org
TOPSAN - The Network News | News of interest to The Open Protein Structure Annotation Network
TOPSAN – The Network News. News of interest to The Open Protein Structure Annotation Network. New TOPSAN Paper and Download Details. November 10, 2010. A paper on TOPSAN, entitled: “ TOPSAN: a dynamic web database for structural genomics. 8221; will be featured in the Nucleic Acids Research upcoming database issue. As a brief introduction, the three formats we have provided contain semantic web related data. Which better enables data organization and easier machine parsing. The three formats include:.
Topsana's Shop
0 item(s) ($0.00). Topsana's Shop offers home and kitchen decor along with lighting and outdooring iving. Black Manhattan Candle Lantern. Add to wish list. Add to wish list. White Tear Drop Oil Warmer. Add to wish list. Add to wish list. Sapphire Night Hanging Lantern. Add to wish list. Aquamarine Filigree Candle Lantern. Add to wish list. Add to wish list. Retro Owl Wall Hook. Add to wish list. More gifts to choose from. Tall Floret Blue Candle Lantern. Add to wish list. Add to wish list.
Topsanah District
Skip to main navigation. Skip to 1st column. Skip to 2nd column. Friday, 01 May 2015 19:30. Topsanah District monthly Roundtables are meeting at Trinity Presbyterian Church at. 5500 Morriss Rd. Flower Mound, TX 75028. Come join us on the first Tuesday of the month at 7:30 pm. for fun and Scouting Fellowship. Last Updated on Sunday, 10 May 2015 22:19. WHERE CAN I FIND OUT ABOUT the CHANGES TO THE CUB SCOUT PROGRAM? Tuesday, 03 February 2015 03:06. Last Updated on Tuesday, 03 February 2015 03:29. Past Dist...
Blog de topsanandreas - vous aimez gta sanandreas alors c'est par ici allez vient et laisse beaucoup de commentaires - Skyrock.com
Mot de passe :. J'ai oublié mon mot de passe. Vous aimez gta sanandreas alors c'est par ici allez vient et laisse beaucoup de commentaires. Ici c'est topsanandreas il y auras plein de tof de gta sanandreas alors laisser des commentaires beaucoup de commentaires. Mise à jour :. Ou sinon vas voir ce blog de ouf. Vas le voir ce blog de ouf. Vas voir ce blog de oufs. Vas voir ce blog de oufs c'est un blog de. Liberty City$ Pr Agrandir la Carte au. Vas voir ce blog de fous. Vas voir ce blog de fous . Pr Agran...
TM Webhosting Default Page
This is the default page for domain www.d1051477.netmyne.net. If you see this page after uploading site content you probably have not replaced the. This page is autogenerated by Telekom Malaysia Berhad.